PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g046390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 557aa    MW: 63664.6 Da    PI: 9.0276
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g046390.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.33.2e-1429106996
                     HHHHTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   9 dvlksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                       ++++ l +p  f+ ++  g+++  + t  l++ +s  +Wevk+  ++++    l+ GW +F+ a++L++gD+vvF+++g    elv++v
  Csa16g046390.1  29 PDFTNH-LDIPVAFFLKYlvGSNE--GNTAELRSdSSETTWEVKI--DGRR----LSHGWDDFAIAHDLRVGDIVVFRHEG----ELVFHV 106
                     556666.99*********977664..456777764888*******..9998....99*********************765....444444 PP

2B362.47.3e-20158251297
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f +++++++l+++ ++lpk+fa+++g+k+  + +++l++e+g+sW++ l+++ ++++ + +++GW++F+ ang k gD + Fkl++ +++++v++
  Csa16g046390.1 158 FVTTVTASNLRRDTVYLPKEFARSNGLKN--KLKIVLMNEEGESWTIDLRHEAYPSGrFNMRRGWRRFCVANGKKPGDKMAFKLVQ-NKKTPVLQ 249
                     5677899******************9995..458***************995555444**************************99.55558887 PP

                     EE CS
              B3  96 vf 97 
                     +f
  Csa16g046390.1 250 LF 251
                     76 PP

3B360.23.5e-19293373688
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     ++ ++l ++r++lpkkf+ ++g+ k  ++++ l++e+g+sW++ ++++ +sgr++ t+GW++F+ an+ k gD ++Fkl++++
  Csa16g046390.1 293 VTTSNLWRDRMYLPKKFVLSNGLLK--KFQMLLMNEEGESWKIDVKHEAYSGRFLTTRGWRSFCVANDKKPGDWFIFKLVQNQ 373
                     567778889************9995..568************************************************99863 PP

4B344.23.5e-144745551499
                     T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     + l lp +f++++g++k++  ++t+ d  g +W+  l +++++ ++ l+kG k+F++ +g+k  +++v++l++ +++ +++k+++k
  Csa16g046390.1 474 SKLNLPLEFMKANGINKAG--KITMLDIYGSRWRTSLLMDNRG-TMSLGKGSKGFCEVHGVKMHESFVLELIW-EDTVPLLKFCSK 555
                     5689************887..7***************766665.678**************************.788899999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.8E-2017114IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-2018118IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.33520112IPR003340B3 DNA binding domain
CDDcd100171.86E-1521107No hitNo description
SMARTSM010191.6E-2023112IPR003340B3 DNA binding domain
PfamPF023624.2E-932105IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.3E-22155248IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.481157254IPR003340B3 DNA binding domain
CDDcd100175.76E-17157252No hitNo description
SuperFamilySSF1019361.67E-20157252IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-31158254IPR003340B3 DNA binding domain
PfamPF023628.2E-19158251IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-20283378IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.6E-19284378IPR015300DNA-binding pseudobarrel domain
CDDcd100178.50E-17288370No hitNo description
PROSITE profilePS5086313.112288383IPR003340B3 DNA binding domain
SMARTSM010196.8E-24289384IPR003340B3 DNA binding domain
PfamPF023623.6E-17292374IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-14460555IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.305461555IPR003340B3 DNA binding domain
SuperFamilySSF1019365.49E-15462554IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.4E-20465556IPR003340B3 DNA binding domain
CDDcd100175.72E-10474554No hitNo description
PfamPF023622.5E-12474555IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MTKNKKKGNM VNQPLYSPIN PHFFQPLLPD FTNHLDIPVA FFLKYLVGSN EGNTAELRSD  60
SSETTWEVKI DGRRLSHGWD DFAIAHDLRV GDIVVFRHEG ELVFHVSALG PSCCEIQYRE  120
DKKEKLCDTV TEKVSIKKKS LKREAADSTP DHSLDSCFVT TVTASNLRRD TVYLPKEFAR  180
SNGLKNKLKI VLMNEEGESW TIDLRHEAYP SGRFNMRRGW RRFCVANGKK PGDKMAFKLV  240
QNKKTPVLQL FPMDSEDREK LDSTVDTENV PRKKSRKEED YSPDDCSSFV ASVTTSNLWR  300
DRMYLPKKFV LSNGLLKKFQ MLLMNEEGES WKIDVKHEAY SGRFLTTRGW RSFCVANDKK  360
PGDWFIFKLV QNQEIPVLRE FPMYSEDRHK LEPSSDTRQG KCLKATKAEF LGLEDYRDDS  420
TQGNCFKASI AEPTDEDIRQ RKHSQAIKQE YASAQGNNST GQNRLVTLTL TPASKLNLPL  480
EFMKANGINK AGKITMLDIY GSRWRTSLLM DNRGTMSLGK GSKGFCEVHG VKMHESFVLE  540
LIWEDTVPLL KFCSKV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472482.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X1
SwissprotP0DH850.0REM10_ARATH; B3 domain-containing protein REM10
TrEMBLR0FW980.0R0FW98_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_40003920.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144901522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.10.0B3 family protein